PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G279000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 405aa    MW: 44946.4 Da    PI: 5.1663
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G279000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.1e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +grWT+eEde+l +++   G g+W++ ++  g++R++k+c++rw +yl
  Aqcoe2G279000.1.p 14 KGRWTAEEDEILSKYIDANGEGSWRSLPKNAGLKRCGKSCRLRWINYL 61
                       79********************************************97 PP

2Myb_DNA-binding53.26.7e-1767112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg+ T+eE++ +++ ++ lG++ W++Ia +++ gRt++++k++w+++l
  Aqcoe2G279000.1.p  67 RGNITPEEEDTIIKMHNTLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                        7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-21564IPR009057Homeodomain-like
PROSITE profilePS5129417.705961IPR017930Myb domain
SuperFamilySSF466892.16E-2811108IPR009057Homeodomain-like
SMARTSM007172.7E-111363IPR001005SANT/Myb domain
PfamPF002497.7E-141461IPR001005SANT/Myb domain
CDDcd001675.76E-81661No hitNo description
PROSITE profilePS5129423.6662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2565116IPR009057Homeodomain-like
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002493.5E-1567112IPR001005SANT/Myb domain
CDDcd001678.07E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTAE EDEILSKYID ANGEGSWRSL PKNAGLKRCG KSCRLRWINY  60
LRGDLKRGNI TPEEEDTIIK MHNTLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRRIQTFR  120
RPFVESPPKV MIDIVKMRGE CKRKGRTSRA AMKKNNIMNN PHKIPSIVKK VFVNKSEEGE  180
KSIEGVLIPS TPLQEEKLKD VKESQNNPVQ GPNLASENIG IILNSSEERE CVRSSSLNGD  240
DSEDGILGPY QGLESCKLFG GDIIMGDWVL LSPSGILPHN NEEKQNVAIH PLSSEEQLGL  300
LGSTSNGNMA SSEEGESGGI SSSNGAAESG EWYSSCSMTS CFEDDWVNWD WEGVVESPNN  360
KKFLSNEGEE LLSWLWDNND SGKGGEMLMD CEEQNKALAA WLLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-22121185110B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268044.11e-103PREDICTED: myb-related protein P-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.15e-76myb domain protein 12